SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7BFE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7BFE5
Domain Number 1 Region: 230-514
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.57e-36
Family Ankyrin repeat 0.0022
Further Details:      
 
Domain Number 2 Region: 59-220
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000113
Family Ankyrin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 509-552,609-640
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000942
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P7BFE5
Sequence length 693
Comment (tr|A0A0P7BFE5|A0A0P7BFE5_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:KPM41718.1} KW=Complete proteome; Reference proteome OX=78410 OS=Neonectria ditissima. GN=AK830_g4822 OC=Neonectria.
Sequence
MAVIEDLPCEVVLQIADECVRGVHPKLGQYPSSYAKYHSHLARTSRHFYAMLNLELYKRN
VHEDPPLDSCVLWAATSGQLNTIRLAHGLGADLSNNGSSRDPDNKGPGVYGVPGRSGFSA
APLHLAIFNGHRDIVEYLLDNGAVVDVEARRFCVGNAREINSHCPSFPYPLHVALAHKSG
VEDAAAMLIKHGAHLMASNMDAFPIVAQSGRVDLVRLLLELDEPAVTAAALRYAVEMRDA
DLFWRMMARPNLNVATPDHTGRTALHFAARLDDMTYAMAILQRPEVNAAAADDRLRTALH
TAAKRGNLPLVERILQHQEVNAAFPDEMERTALHFAVAAKSVGVTKRLLERAEVNAGVWS
TMIDTRTPIQLAIHLGVPELVDMLLARHDVSATMVEYNGRTLLHHLVDTKNKTGAMAPFV
DKLIARGVPIDAVADVDTALLYAIKRSKFAMALTLLEHNASTDITPPDPFLWTPLHHCLF
GHGPKQTELVAKLISLGTGMDSYAEPNENGSTAYNTISCGSQLFFAAVYARNIDCMKLLI
DAGAAVHSNVMYTERDQSESGLNFGDQESLLAGIFRHRLRIVPASDDCVEEVREITCLLL
QHGAALEPVDESRSALDWGYLAAIRHGSFALLNLLLDNSTKDNAPAFFIEDVAVRCRANM
LNPDNQQVIRLLTRFMTREYPGMDLDGLPSESG
Download sequence
Identical sequences A0A0P7BFE5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]