SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7BQA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7BQA5
Domain Number 1 Region: 317-438
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-31
Family cAMP-binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 177-319
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.82e-26
Family cAMP-binding domain 0.0000365
Further Details:      
 
Domain Number 3 Region: 5-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000759
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P7BQA5
Sequence length 458
Comment (tr|A0A0P7BQA5|A0A0P7BQA5_9HYPO) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=78410 OS=Neonectria ditissima. GN=AK830_g3440 OC=Neonectria.
Sequence
MAVLPEAYQVEIQALNLQVLQARPSDILQFCADYFTTRLVNQRAASHAKAGDTYLYTTRS
NYPSQHDMANTFQSPFGDNNNPFGGSAPGNNMMQRVIEEEENDTITSPTNRSFGAGSSSL
FSGTFGGGDASDDQPPTARSPPNPDSYPAQYNFARRTSVSAESLKPSADTYDNWTPPYHE
KTAEQLDRLQRAIEGNFLFSHLEDEQSAQILGALVEKPIPAKGIKVISQGDAGDYFYVVE
KGSFDVHVNPTGSLQPGLDGMGDKVGNIQAGGSFGELALMYNAPRAATVVSAESGCTVWA
LDRVTFRRILMESTFARRRIYESFLKEVPILSTLTPYERSKIADALETKKFPSGEIIIKE
GDPGHAFYLLENGQAAAYKGDPSNKVLDYDKGDYFGELALLNDAPRAASVVATTDVKVAS
LGKNAFQRLLGPVEGIMRRTEYQNADAGVEEMDPLHTG
Download sequence
Identical sequences A0A0P7BQA5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]