SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7UXV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7UXV0
Domain Number 1 Region: 33-206
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.2e-63
Family Crystallins/Ca-binding development proteins 0.0000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P7UXV0
Sequence length 243
Comment (tr|A0A0P7UXV0|A0A0P7UXV0_9TELE) Beta-crystallin B1-like {ECO:0000313|EMBL:KPP66510.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_114979 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
RRASFGAFTPGWERAASRRHSAXXXXXXXXXXQIMLYEQENFQGRMVPVQNECVNLVDHG
FERVRSVRVECGPWVAFEQPNFRGEMFILEKGEYPRWDTWSNSYRSDCLMSFRPIRMDPQ
EHKICLYELCDFKGNKMEIMEDDVPSLWAHGFTNRVGSVIVSGGAWVGYQYPGYRGYQYL
FECGEYRHYNDFCAIQPEIQSIRRVRDMQFHQRGCFTFAAAGTGTSSSSSSSSSSSGSGS
TSK
Download sequence
Identical sequences A0A0P7UXV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]