SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7V2L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7V2L7
Domain Number 1 Region: 16-69
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000141
Family G proteins 0.0025
Further Details:      
 
Domain Number 2 Region: 62-101
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 0.000000000968
Family Transducin (alpha subunit), insertion domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P7V2L7
Sequence length 102
Comment (tr|A0A0P7V2L7|A0A0P7V2L7_9TELE) Guanine nucleotide-binding protein subunit alpha-14-like {ECO:0000313|EMBL:KPP75246.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_105521 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MAGCCLTAEQRECKKINKEIERQLNRDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGS
GYTEEDKMGFAKLVYQNIFTSMQVMIRAMETLNIQFANSENI
Download sequence
Identical sequences A0A0P7V2L7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]