SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7WR68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7WR68
Domain Number 1 Region: 117-238
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-34
Family cAMP-binding domain 0.000000566
Further Details:      
 
Domain Number 2 Region: 246-370
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-32
Family cAMP-binding domain 0.000000536
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.49e-20
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P7WR68
Sequence length 379
Comment (tr|A0A0P7WR68|A0A0P7WR68_9TELE) cAMP-dependent protein kinase type I-alpha regulatory subunit-like {ECO:0000313|EMBL:KPP64306.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_117369 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MASGSTSSEEERSLRECELYVQKHNIQQLLKDCIVQLCTSRPDRPMAFLREYFERLEKEE
AKQILNQQKSSSRSDSREEEVSPPMNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDY
KTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVTYIAGETVILQGDEGDNFYVIDQGEM
DVYVNNEWVTSIGEGGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGSTLRK
RKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGCAAV
LQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPC
SDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A0P7WR68
XP_018616894.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]