SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7YF06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7YF06
Domain Number 1 Region: 19-100
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000926
Family Snake venom toxins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P7YF06
Sequence length 124
Comment (tr|A0A0P7YF06|A0A0P7YF06_9TELE) Sperm acrosome membrane-associated protein 4-like {ECO:0000313|EMBL:KPP64999.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_116612 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MSVTVVSMLVTLVLFTQSWALNCYKCDLGLWNMCITTTTSCKCGESCFTGFGKAAKLLDI
RMKGCLKSKDCNTVSTVEFLSNATYSMMKTCCATDLCNVAPGLSQLALLSLALAMFVLVQ
LTGV
Download sequence
Identical sequences A0A0P7YF06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]