SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7YH29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7YH29
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.75e-19
Family Integrin beta tail domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P7YH29
Sequence length 154
Comment (tr|A0A0P7YH29|A0A0P7YH29_9TELE) Uncharacterized protein {ECO:0000313|EMBL:KPP66316.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_115195 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
DCVQCRAFGTGEKKETCERDCGYFKLIKVKDRDKLPQPVQAFPLMHCKERDNNDCWFYYT
YMVDNNTEKIVHVVEKRECPDIADVLPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFA
KFEKEKMNARWDTGENPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences A0A0P7YH29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]