SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7Z6R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7Z6R1
Domain Number 1 Region: 52-160
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000144
Family Mannose 6-phosphate receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P7Z6R1
Sequence length 279
Comment (tr|A0A0P7Z6R1|A0A0P7Z6R1_9TELE) N-acetylglucosamine-1-phosphotransferase subunit gamma-like {ECO:0000313|EMBL:KPP76410.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_104251 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MKIVEEPNTFGLNNPLLTGSNRLQAKVPPSPVSGPPHLHRLAGKCFSYIESTYKYEFCPF
HNITQHEQSFRWNAYSGILGIWQEWEITNNTFLAMWLREGDSCGTKNRQTKVQRPAARTL
ALALGTAAWSIQERNSKLAHVSEPSTCMYLLRFETPLVCHPHSLLVYPTLSDKLQKQWDE
AEQALYEELITEQGYNSMLKDIFEEAGFLKTQKVNDNQQSKTTTKNFESLEQCTEKLSED
VDRLKALLTQHNIPHEKETGETSVSTGPQHLAGEHAVGV
Download sequence
Identical sequences A0A0P7Z6R1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]