SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P9CF74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9CF74
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 4.55e-29
Family PA0094-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P9CF74
Sequence length 142
Comment (tr|A0A0P9CF74|A0A0P9CF74_VARPD) Uncharacterized protein {ECO:0000313|EMBL:KPV36934.1} KW=Complete proteome OX=34073 OS=Variovorax paradoxus. GN=APR47_10190 OC=Comamonadaceae; Variovorax.
Sequence
MHYHFQRGTVEVPDHYNDRTMHVLVPAGAGFTFIISQDELEPGESPEAFVQRQLGNLARQ
VTKFEETAREAIFLGPPEQGVQGLRIEFRYRQRGSFSYQCQGIFPLSDRKTLLTFTASAA
APFDAPQLQLWRQMVASVALRR
Download sequence
Identical sequences A0A0P9CF74 A0A2E9BTX9
WP_057593172.1.1126 WP_057593172.1.22473 WP_057593172.1.46318 WP_057593172.1.51692 WP_057593172.1.64398 WP_057593172.1.87458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]