SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P9KKR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9KKR1
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 1.83e-38
Family Transcription factor NusA, N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 202-280
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.7e-28
Family Prokaryotic type KH domain (KH-domain type II) 0.00016
Further Details:      
 
Domain Number 3 Region: 134-201
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.68e-17
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 
Domain Number 4 Region: 357-418
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 2.98e-16
Family NusA extra C-terminal domains 0.0032
Further Details:      
 
Domain Number 5 Region: 432-492
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000000127
Family DNA repair protein Rad51, N-terminal domain 0.042
Further Details:      
 
Domain Number 6 Region: 281-345
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.00000000000000719
Family Prokaryotic type KH domain (KH-domain type II) 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P9KKR1
Sequence length 493
Comment (tr|A0A0P9KKR1|A0A0P9KKR1_PSECA) Transcription termination/antitermination protein NusA {ECO:0000256|HAMAP-Rule:MF_00945} KW=Complete proteome OX=86840 OS=Pseudomonas cannabina. GN=ALO81_00860 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSKEVLLVVESVSNEKGVPASVIFEALELALATATKKRFEDEVELRVEINRQTGNYETFR
RWTVVEDEDLDDPAYELAVDQAQAKKPGAVAGDLIEEKIDSIEFGRIAAQTAKQVIVQKV
REAERAQVVDAYRERLGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIISRETFRVGVR
MRALLKEIRTENRGPQLILSRTAPEMLIELFRIEVPEIAEGLIEVMAASRDPGSRAKIAV
RSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDDNPAQFVINAMSPAEVAAIIV
DEDAHAMDIAVGADNLAQAIGRGGQNVRLASQLTGWTLNVMTESDIQAKQQAETGDILRN
FIEELEVDEELAQVLVDEGFTSLEEIAYVPLEEMLNIDGFDEDIVNELRARAKDRLLTKA
IATEEKLADAHPAEDLLSLEGMDKDLAMELAVRGVITREDLAEQSIDDLLDIDGIDDDRA
GKLIMAARAHWFE
Download sequence
Identical sequences A0A0N0FEM8 A0A0N0GH50 A0A0P9HZ89 A0A0P9KKR1 A0A0P9QL24 A0A1I4ITX5 F3HG45
WP_007249023.1.46317 WP_007249023.1.49217 WP_007249023.1.52488 WP_007249023.1.55598 WP_007249023.1.72319 WP_007249023.1.75137 WP_007249023.1.87572 WP_007249023.1.89797 WP_007249023.1.93459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]