SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P9SGP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9SGP1
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.73e-40
Family PA0094-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P9SGP1
Sequence length 154
Comment (tr|A0A0P9SGP1|A0A0P9SGP1_9PSED) Uncharacterized protein {ECO:0000313|EMBL:KPX41844.1} KW=Complete proteome OX=251654 OS=Pseudomonas syringae pv. helianthi. GN=ALO68_01871 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MDYQLHEGSIALPDGFKDRTVNMFAFGNSVPAPLNITISRDDMLPAEDLSTYISRQVKLI
ANQLRGYTLVGKTPALLSTGQQMSGIQVDAYYMHEGRPVYQRQAAFEITPGRILVFSATS
QTDFSATQDEDWLQLLASFQPRLNDVEPTRTEQE
Download sequence
Identical sequences A0A0P9SGP1
WP_054987806.1.69156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]