SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P9TNM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9TNM6
Domain Number 1 Region: 112-268
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.62e-26
Family PH0987 C-terminal domain-like 0.00045
Further Details:      
 
Domain Number 2 Region: 26-116
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.000000000000103
Family PH0987 N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P9TNM6
Sequence length 310
Comment (tr|A0A0P9TNM6|A0A0P9TNM6_9PSED) Uncharacterized protein {ECO:0000313|EMBL:KPX42542.1} KW=Complete proteome OX=251654 OS=Pseudomonas syringae pv. helianthi. GN=ALO68_02292 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSRITDVCLPFYNDFKKGTDMADPIRYSFGADEHLFAEVSDSMSLEAFFKGLAVTRAVER
LALDGVLDVCLANASFQIRFDPDRIAPQALLEAVRAAEAGAVAERTLQTRIIEIPVLYND
PWTHETLMRFRDRHQDPGSTDLEYAARINNLADVDAFIAAHSGAPWFVSMVGFVAGLPFM
FQMVERERQLQVPKYLRPRTDTPKLTLGHGGCFGCIYSVRGAGGYQMFGVTPAPIYDPQQ
RLAYLKEHMVFFRPGDIVQFKPLDRQAYDAAVAQVEAGHFDLRIRPVEFSLDAFLADPAG
YPKSLQEVLA
Download sequence
Identical sequences A0A0P9TNM6 A0A0Q0BHG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]