SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q0DRK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0Q0DRK7
Domain Number - Region: 30-60
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0641
Family N-terminal coiled coil domain from apc 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q0DRK7
Sequence length 90
Comment (tr|A0A0Q0DRK7|A0A0Q0DRK7_PSESX) Uncharacterized protein {ECO:0000313|EMBL:KPZ31612.1} KW=Complete proteome OX=103985 OS=Pseudomonas syringae pv. theae. GN=AN901_200982 OC=Pseudomonadaceae; Pseudomonas; Pseudomonas syringae.
Sequence
MIGLNPMHISVMLLLTEVLLTGIAGFQVYLFRQVSTARRENMELRIEMAKHSGKQEATDS
ALLKLEHRFEKRLEHCLDAYFANLNKRNTP
Download sequence
Identical sequences A0A0Q0DRK7
WP_019331940.1.18673 WP_019331940.1.25462 WP_019331940.1.28366 WP_019331940.1.50828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]