SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q0V6Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q0V6Z6
Domain Number 1 Region: 6-62
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000562
Family Myb/SANT domain 0.023
Further Details:      
 
Weak hits

Sequence:  A0A0Q0V6Z6
Domain Number - Region: 107-155
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0068
Family Mitotic arrest deficient-like 1, Mad1 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q0V6Z6
Sequence length 168
Comment (tr|A0A0Q0V6Z6|A0A0Q0V6Z6_BACTU) RsfA family transcriptional regulator {ECO:0000313|EMBL:AQY40393.1} KW=Complete proteome OX=1428 OS=Bacillus thuringiensis. GN=B4918_21670 OC=Bacillus cereus group.
Sequence
MATTRQDAWTDDEDLLLAEVVLRHIREGGTQLSAFKEVGKNLSRTPAACGFRWNSYVRKQ
YKERIEEAKQLRKVENYEVKETKVLEPTSITLNDVIDFLQNYKDENSLTVLQQQVESLQT
ERERLLERLSVYEEEYRTLLDYIDQKRSVMVVERNNARSNEKLEKLKK
Download sequence
Identical sequences A0A0Q0V6Z6 A0A0Q9GGM3 A0A0Q9H125 A0A150DJI2 A0A160LDW1 A0A1H5ZD16 A0A242XW21 A0A243BFL7 A0A243EBH9 A0A243MAF9 A0A2H3Q9R8 B7IVF7 C3DNY2 J3ZXH3 J7WRC7 J8CRA8 R8CEV8 R8IU08 R8RSK3 R8YR41
gi|434377027|ref|YP_006611671.1| WP_000246470.1.100497 WP_000246470.1.101720 WP_000246470.1.101838 WP_000246470.1.12935 WP_000246470.1.13269 WP_000246470.1.22084 WP_000246470.1.26459 WP_000246470.1.27446 WP_000246470.1.28599 WP_000246470.1.34537 WP_000246470.1.3546 WP_000246470.1.35769 WP_000246470.1.36279 WP_000246470.1.38325 WP_000246470.1.4447 WP_000246470.1.48759 WP_000246470.1.50042 WP_000246470.1.52284 WP_000246470.1.58712 WP_000246470.1.59384 WP_000246470.1.60526 WP_000246470.1.61799 WP_000246470.1.61820 WP_000246470.1.61919 WP_000246470.1.6241 WP_000246470.1.64421 WP_000246470.1.70667 WP_000246470.1.73638 WP_000246470.1.83666 WP_000246470.1.87649 WP_000246470.1.87705 WP_000246470.1.89145 WP_000246470.1.89325 WP_000246470.1.92555 WP_000246470.1.9703 WP_000246470.1.97821 WP_000246470.1.97830 WP_000246470.1.98315 gi|402564733|ref|YP_006607457.1| gi|218899076|ref|YP_002447487.1| 405531.BCG9842_B1218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]