SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q1AI78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q1AI78
Domain Number 1 Region: 171-252
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.83e-22
Family eIF-2-alpha, C-terminal domain 0.0041
Further Details:      
 
Domain Number 2 Region: 83-169
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 2.35e-21
Family eIF2alpha middle domain-like 0.0058
Further Details:      
 
Domain Number 3 Region: 4-86
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.93e-19
Family Cold shock DNA-binding domain-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q1AI78
Sequence length 262
Comment (tr|A0A0Q1AI78|A0A0Q1AI78_9EURY) Translation initiation factor IF-2 subunit alpha {ECO:0000313|EMBL:KQC09038.1} KW=Complete proteome; Reference proteome OX=1735327 OS=Methanolinea sp. SDB. GN=APR55_10830 OC=Methanoregulaceae; Methanolinea.
Sequence
MTEREWPETGELVVCTVRDVKDFAAFVALDEYPGREGLIPISEIATGWIKYIRDHVREGQ
KVVCKVLHVDTGRGHIDLSLKDVNEHQRREKIREWKNESKAAKWIGFAANTAGVPAEEIE
NIVYQKYGDLYSIFEDIVTRGDSAFQKTGLSDPVKEALVTVAHENVKVPRVTVSGNLVLT
STKPDGVNIIRRALRSAEPKIQDVEIEITYLGAPLYRIKVTAPDYKSAEKAIEKAAAAAI
GVVERADGEGKFVKKPKSGKAT
Download sequence
Identical sequences A0A0Q1AI78

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]