SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q2MCK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q2MCK9
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily YfbU-like 9.68e-63
Family YfbU-like 0.000000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q2MCK9
Sequence length 166
Comment (tr|A0A0Q2MCK9|A0A0Q2MCK9_VIBFU) UPF0304 protein AMR76_13290 {ECO:0000256|HAMAP-Rule:MF_00762} KW=Complete proteome OX=29494 OS=Vibrio furnissii. GN=AMR76_13290 OC=Vibrionaceae; Vibrio.
Sequence
MEMTNAQRLILSNQYTLMSQLDPQNAAKYKRLQTIVERGYELQMCELNKEFGCISEAQCR
EVIDIMEMYHAMQESFNMLEEDERKDVDVRRLNYLGYDIASEAQLVNYVRFLVNAEGLYP
QFDKGDHHFNSQMPMQEKYRRMLTTWRNCPRQYHLSASELRQIFNA
Download sequence
Identical sequences A0A0Q2MCK9 A0A1X1LIV5
WP_004726443.1.16057 WP_004726443.1.30636 WP_004726443.1.84411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]