SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q3P050 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3P050
Domain Number 1 Region: 34-135
Classification Level Classification E-value
Superfamily SH2 domain 7.67e-27
Family SH2 domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 149-196
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000131
Family SOCS box-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3P050
Sequence length 197
Comment (tr|A0A0Q3P050|A0A0Q3P050_AMAAE) Suppressor of cytokine signaling 2, variant 1 {ECO:0000313|EMBL:KQK73875.1} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_163146 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MTLRSAESLESTEGSRARWRHPGTAAPVAEEFCEAAQLATAMEELRRAGWYWGNMTVAEA
KERLQDAPEGTFLVRDSSHSEYLLTISVKTSAGPTNLRIEYQDGKFRLDSITCVRSRLKQ
FNSVVHLIEYYVLMCKNRTEAPSNGTVHLYLNKPLYTSTPSLQHRCRITINKCTNQIWEL
PLPTRLKEYLKEYQYQV
Download sequence
Identical sequences A0A0Q3P050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]