SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q3RH07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3RH07
Domain Number 1 Region: 43-105
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 2.75e-17
Family Interleukin 8-like chemokines 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3RH07
Sequence length 115
Comment (tr|A0A0Q3RH07|A0A0Q3RH07_AMAAE) C-C motif chemokine {ECO:0000256|RuleBase:RU361150} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_44527 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MAPMGLGXXEXLVGSPEEKDLRPWGWLSSAALGASPSGRRSPGALAVPDKCCFNFQMRRI
KRDNIIACYPTSPECPHKAVIFRVRSGKEICTQASRAWVKKYQQSFPVSSFSIPS
Download sequence
Identical sequences A0A0Q3RH07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]