SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q3T978 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3T978
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 3.33e-21
Family NIPSNAP 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3T978
Sequence length 101
Comment (tr|A0A0Q3T978|A0A0Q3T978_BRECH) NIPSNAP family containing protein {ECO:0000313|EMBL:KQL50009.1} KW=Complete proteome; Reference proteome OX=54911 OS=Brevibacillus choshinensis. GN=AN963_10150 OC=Brevibacillus.
Sequence
MVTCYLKYVIDPYQVDVFEEYAKMWIPLVNKFGGQHHGYFLPHEGANNIAYALFSFPSLA
EYEDYRKKILVDEDCKKAFILAEQTKCIISFERSFLRPVLE
Download sequence
Identical sequences A0A0Q3T978
WP_055744347.1.18681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]