SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q3TBH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3TBH9
Domain Number 1 Region: 1690-1865
Classification Level Classification E-value
Superfamily Fibronectin type III 1.63e-29
Family Fibronectin type III 0.0000845
Further Details:      
 
Domain Number 2 Region: 2056-2224
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-23
Family Fibronectin type III 0.0000134
Further Details:      
 
Domain Number 3 Region: 1421-1590
Classification Level Classification E-value
Superfamily Fibronectin type III 4.98e-23
Family Fibronectin type III 0.0000252
Further Details:      
 
Domain Number 4 Region: 1059-1226
Classification Level Classification E-value
Superfamily Fibronectin type III 6.43e-23
Family Fibronectin type III 0.00086
Further Details:      
 
Domain Number 5 Region: 1875-2045
Classification Level Classification E-value
Superfamily Fibronectin type III 2.21e-22
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 875-1041
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-21
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 7 Region: 537-592
Classification Level Classification E-value
Superfamily Kringle-like 5.71e-21
Family Fibronectin type II module 0.0000556
Further Details:      
 
Domain Number 8 Region: 1597-1687
Classification Level Classification E-value
Superfamily Fibronectin type III 6.98e-21
Family Fibronectin type III 0.00000647
Further Details:      
 
Domain Number 9 Region: 476-532
Classification Level Classification E-value
Superfamily Kringle-like 4.85e-19
Family Fibronectin type II module 0.00012
Further Details:      
 
Domain Number 10 Region: 1242-1409
Classification Level Classification E-value
Superfamily Fibronectin type III 4.79e-17
Family Fibronectin type III 0.0000189
Further Details:      
 
Domain Number 11 Region: 686-732
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000145
Family Fibronectin type I module 0.00092
Further Details:      
 
Domain Number 12 Region: 2490-2533
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000239
Family Fibronectin type I module 0.00059
Further Details:      
 
Domain Number 13 Region: 644-688
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000598
Family Fibronectin type I module 0.0014
Further Details:      
 
Domain Number 14 Region: 356-400
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000124
Family Fibronectin type I module 0.0000652
Further Details:      
 
Domain Number 15 Region: 600-640
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000013
Family Fibronectin type I module 0.00079
Further Details:      
 
Domain Number 16 Region: 2445-2488
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000015
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 17 Region: 219-264
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000329
Family Fibronectin type I module 0.0000772
Further Details:      
 
Domain Number 18 Region: 309-355
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000613
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 19 Region: 175-216
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000239
Family Fibronectin type I module 0.00032
Further Details:      
 
Domain Number 20 Region: 267-307
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000493
Family Fibronectin type I module 0.0000704
Further Details:      
 
Domain Number 21 Region: 2533-2574
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000299
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 22 Region: 730-851
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000053
Family Fibronectin type III 0.0000299
Further Details:      
 
Domain Number 23 Region: 435-473
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000117
Family Fibronectin type I module 0.00033
Further Details:      
 
Domain Number 24 Region: 2358-2424
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000651
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3TBH9
Sequence length 2628
Comment (tr|A0A0Q3TBH9|A0A0Q3TBH9_AMAAE) Fibronectin isoform X1 {ECO:0000313|EMBL:KQK77742.1} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_122333 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MFCEMARPSCSQLSLRGRASHQRRAPSAAQTRPDPARPSSALCGDRAGSPALDRAVAAPA
RPPATPRPMGAGAASGSPSPLRPPYIAPGRRRCPVRRAACERLRCTCRAVPCRAVPCRAV
PCRAVPCLALLALCLGAAAAGGGGGGGGQRRGGGGKSRRQAQTTSVPQGTPAQGKQTCYD
NGRYYQINQQWERIYLGNTLVCTCYGGSRGFNCESKPEPEETCFDKYTGSTYRVGETYER
PKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGK
GEWTCKPVAERCYDNTAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDH
DTKTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLHTTSTGSGSPSFTNVQTA
LYQPQPQQPQPQPYGQCITDNGVVYSVGMQWLKTQGSQQMLCTCLGNGVSCQEIAVTQTY
GGNSDGEACVLPFTYDGRTFYSCTTEGRTDGHLWCSTTSNXEQDRRYSFCTEQNVLVQTR
GGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTENYDADQKFGFCPMAAHEEICT
TNDGVMYRVGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDGITYDVNQTF
HKRHDEGHMLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYG
RGIGEWHCQPLQTYPGSSGPVQVIITESTNQPNSHPIQWNAPERSHITKYILRWRPVSAT
CIVICSPKCCIFWLFVVSKNSGRPWKEATVPGYQNSYTISGLKPGVIYEGQLISVQQYGH
KEVTRFDFTTTSTTAVTSNTVSGETTLLPPVVATSESVTEITSNSFVVSWVSASDTVSGF
RVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEEGEQNLILSTSQTTA
PDAPPXHAVESVDDTSIVISWSRPQAPITGYRIIYTPSVEGSSTELNLPDTATSVTLSDL
MPGVQYNISIYAVEENQESTPIFIQQETTGVPRADEVPSPKDLQFVEVSDIKITIMWTPP
QSQVSGYRVEVIPVNRPGQHGQRLPVTRSSFAEIIDLLPGTTYLFKIFAVSQGRXSKPLT
GQQTTKLDAPTNLRFINTTEHSVLVLWTRPRAVITGYRLTAGPTRGGQPRTYNVGPSAAK
YLLRNLQPGTEYTVYLVAVKDDLQSARETGVFTTYQPAGSIPPFNTEVTETSIVITWTPA
PRIGFKLGVRPSQGGEAPREVISDSGSIVISGLTPGVEYTYNVTVLMDGQERETPIIRRV
ITPLSPPTNLRLEPNPDTGILIVSWDXSTTPGISGYRVTTAPTDGQQGSTLEEVVGADQT
TCTFENLNPGVEYNVSVYTVKDDQESIPISETITQEVPQLTDLSFVDITDSSIGLRWTPL
NASTIIGYRITVVAAGESVPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPT
TLTQQTAVPPPTDLRFTNVGPDTMRVTWTAPTSIVLSSFLVRYSPVKKEEDVAELTISPS
DNMVILTNLLPGTEYLVRVYSVSEQHESAPLSGIQKTALDSPTGLDFSDITANSFTVHWI
APRATITGYKIRHHPEHGAGRPKEDRVPPSRNSITLTNLLPGTEYVVSIIAINGREESLP
MVGQQTTVSDVPRDLEVTPTSPTSLVISWDAPAVTVRYYRITYGETGGSSPVQEFTVPGT
MSTATITGLKPGVDYTITVYAVTGRGDSPASSKPVTVTYKTEIDTPSQMQVTDVQDNSIS
IRWLPSTSPVTGYRVTAVPKKGHGPTKTKNVPADQTQVTIEGLQPTVEYMVSVYAQNQNG
ESLPLVETAVTNIDRPKGLTFTEVDVDSIKIAWESPQGQVTRYRVTYSSPEDGIHELLPA
PGGEEDTAELHGLRPGSEYTINIVAIYDDMESLPLTGTQSTAIPPPTNLKFTQVTPTSLT
VNWNAPNVRLTGYRVRVNPKEKTGPMKEINLSPDSTSAVVSGLMVATKYEVSVYALKDSL
TSRPAQGVVTTLENVSPPRRARVTDATETTITITWRTKTETITGFQIDAVPASGQNPIQR
TISPDVRTYTITGLQPGNDYKIYLYTLNENARSSPVVIDASTAIDAPSNLRFLTTTSNSL
LATWQPPRAKITGYIIRYEKPGSPAKEVLPRPRPGTTEATITGLEPGTEYIIYIIAVKNN
QKSEPLVGRKRTDELPTLITRPHPNQPDILDVPSIDEGTPYHTNNRYDNGNGIQLPGTSG
HPQTIGHQGQQVFFEEHGYRRPVPTTATPLRPGSRRQPPNVDEAIEIPGYQVPIIVEPSY
PHSRGPRRNDTTGQEALSQTTISWRPLLESSEYIISCQPVSQDEDTLQFRVPGTSSSATL
TGLTRGATYNIIVEALKDHRRQKVLEEVVTVGNTVSEGLNQPADDTCFDTYTGSFYSIGE
EWERLSETGFKLWCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTCL
GNGKGEFKCEPHETTCYDDGKMYQVGEQWQKEYFGAICSCTCYGGQQGWRCDNCRRPSVE
VAPEGSAGHTYTQFTQRYHQATNTNVNCPIECFMPLDVQADTQHPRGK
Download sequence
Identical sequences A0A0Q3TBH9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]