SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q3TWL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3TWL3
Domain Number 1 Region: 127-158
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000575
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3TWL3
Sequence length 190
Comment (tr|A0A0Q3TWL3|A0A0Q3TWL3_AMAAE) Uncharacterized protein {ECO:0000313|EMBL:KQK85038.1} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_43004 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MCVIYSEDAHLKTRGSQKQGENWQPVYLLFLTKLITQHTNCQDLRRSEDRRKCFSHGHQD
HAESEMEESNTPPAAGTSXDQTPIAESPSSLPASQDWSPGIDFPTSSTCETSEQPKVYED
PFEVSAKYMEKHKILEIFQEITEKXVYEKPDDPLQFMLVQVQSMIHAREAGTSERMLEED
EDEMFLEEVL
Download sequence
Identical sequences A0A0Q3TWL3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]