SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q3WIS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3WIS1
Domain Number 1 Region: 31-73
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.000017
Family Copper amine oxidase, domain N 0.01
Further Details:      
 
Domain Number 2 Region: 87-135
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.0000732
Family Copper amine oxidase, domain N 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3WIS1
Sequence length 259
Comment (tr|A0A0Q3WIS1|A0A0Q3WIS1_BRECH) Copper amine oxidase {ECO:0000313|EMBL:KQL45637.1} KW=Complete proteome; Reference proteome OX=54911 OS=Brevibacillus choshinensis. GN=AN963_11285 OC=Brevibacillus.
Sequence
MKGKILLAATLGMQMLVAYPAAAAPASPAAAHVYVNGEQASLEKAPILVDQRTYVSASDA
SQILQADWTMSAGSGVLKLSDEQSFTFGLKDGKVAVNGKWSEKGQGAIVRDGQVYLPLRW
LVEQAGGKVAWNAEKKAVEIMAALHEGSLVLLTDDKLTKEEQAYVESVKKKQGIYQQGKL
YVVARGESPNPGYGLQVTHTQWSWEQLLVYVKQTKPEPGKMYTQAITYPHIVAKADLPPY
TTVVFLDADTKKPLFAPEK
Download sequence
Identical sequences A0A0Q3WIS1
WP_055744700.1.18681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]