SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q3WY95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3WY95
Domain Number 1 Region: 100-230
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.59e-49
Family PH0987 C-terminal domain-like 0.00000526
Further Details:      
 
Domain Number 2 Region: 6-105
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 1.01e-18
Family PH0987 N-terminal domain-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3WY95
Sequence length 238
Comment (tr|A0A0Q3WY95|A0A0Q3WY95_9BACI) Kinase inhibitor {ECO:0000313|EMBL:KQL54258.1} KW=Complete proteome; Reference proteome OX=157838 OS=Bacillus shackletonii. GN=AN964_12655 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MLVDYRLHPLGENAVMIELGNDLNLETQEKVHAISSFLDEHPFEWMIEYVPAFSTITIFY
DPFKIMNIINAKSPYDFVCQQLQQLLSKISLRQQVESRVVEIPVCYGGKFGPDLETVASI
NRLTTEEVINIHSSAEYTVYMIGFAPGFPYLGGMSEKIAAPRLQSPRLKIPERTVGIAGK
QTGVYPIETPGGWQLIGRTPIKLFRPKDEVPSLLNAGDKVRFKPISYEEYVEWEGKEA
Download sequence
Identical sequences A0A0Q3WY95
WP_055740024.1.98293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]