SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q4B2V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q4B2V9
Domain Number 1 Region: 29-136
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 0.000000000000549
Family Bacterial S-adenosylmethionine decarboxylase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q4B2V9
Sequence length 137
Comment (tr|A0A0Q4B2V9|A0A0Q4B2V9_9EURY) S-adenosylmethionine decarboxylase {ECO:0000313|EMBL:KQM10766.1} KW=Complete proteome; Reference proteome OX=1713724 OS=Methanomassiliicoccales archaeon RumEn M1. GN=AOA80_11220 OC=unclassified Methanomassiliicoccales.
Sequence
MGPKSGKLLSDEETIERFKQGGEWGLLTSIDLRGCDPEKIADGDYIRKFSVDLCDYIDMK
RFGEPIVVRFGADPRVQGYSLAQLIETSLISGHFAEDTNRAFIDVFSCKEYPPQAVAEYC
KKYFGASEVEYSVSFRT
Download sequence
Identical sequences A0A0Q4B2V9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]