SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q4MDF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q4MDF5
Domain Number 1 Region: 13-144
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 6.28e-34
Family Peptidyl-tRNA hydrolase II 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q4MDF5
Sequence length 145
Comment (tr|A0A0Q4MDF5|A0A0Q4MDF5_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KQN47110.1} KW=Complete proteome OX=1736224 OS=Serratia sp. Leaf51. GN=ASE99_16195 OC=Yersiniaceae; Serratia.
Sequence
MNTPATLLPSLPERCVIVINQQLAAGHAANAAAVLALTLGQRHPSLVGAPLIDADNREHP
GLIPIGISVLVADAEQLTQLHQHLLNDDEMDGIIFPVEGQQTTDYAAFREAVSAVPTESL
QLLGIALAGNKKGVRKLTGKLGLLG
Download sequence
Identical sequences A0A0Q4MDF5
WP_056782378.1.76951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]