SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q4WKH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q4WKH5
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily YccV-like 1.44e-33
Family YccV-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q4WKH5
Sequence length 109
Comment (tr|A0A0Q4WKH5|A0A0Q4WKH5_9RHIZ) DNA-binding protein {ECO:0000313|EMBL:KQO80798.1} KW=Complete proteome OX=1736312 OS=Rhizobium sp. Leaf262. GN=ASF29_18400 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MKQRDAKFTIGEVVRHKVFPFRGVVFDVDPEYANTEEWWNAIPAEIRPDRDQPFYHLLAE
NDETEYVAYVSEQNLIHDESDQPLRNPNITRIFDTTPTGELRAKAAMTH
Download sequence
Identical sequences A0A0Q4WKH5
WP_062449487.1.94634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]