SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q4XUJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q4XUJ7
Domain Number 1 Region: 13-202
Classification Level Classification E-value
Superfamily VC0467-like 2.49e-61
Family VC0467-like 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q4XUJ7
Sequence length 202
Comment (tr|A0A0Q4XUJ7|A0A0Q4XUJ7_9RHIZ) UPF0301 protein ASF28_00660 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome; Reference proteome OX=1736251 OS=Methylobacterium sp. Leaf99. GN=ASF28_00660 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MQTSRSRTADPAYLDGQFLIAMPGLTDARFARSVIYLCAHSADGAMGIILNKAIQNLDMP
DLLIQLEIAQEADAIRLRERVGHMPVLMGGPVDAKRGFVLHTDDFHIDQSTLIIDDGICL
TATVDILRAIADGQGPASAVLALGYAGWQAGQLENEILANGWLTCPADPELIFNTALESK
YERTLRGIGIDPAMLSVSAGHA
Download sequence
Identical sequences A0A0Q4XUJ7
WP_056086281.1.86472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]