SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q5DFY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q5DFY5
Domain Number 1 Region: 8-130
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 2.75e-36
Family Transcription factor NusA, N-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 204-281
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 9.16e-32
Family Prokaryotic type KH domain (KH-domain type II) 0.0000799
Further Details:      
 
Domain Number 3 Region: 136-203
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.36e-21
Family Cold shock DNA-binding domain-like 0.0041
Further Details:      
 
Domain Number 4 Region: 283-346
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 3.27e-17
Family Prokaryotic type KH domain (KH-domain type II) 0.00027
Further Details:      
 
Domain Number 5 Region: 357-418
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000000283
Family NusA extra C-terminal domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q5DFY5
Sequence length 538
Comment (tr|A0A0Q5DFY5|A0A0Q5DFY5_9RHIZ) Transcription termination/antitermination protein NusA {ECO:0000256|HAMAP-Rule:MF_00945} KW=Complete proteome; Reference proteome OX=1736330 OS=Rhizobium sp. Leaf306. GN=ASG19_06010 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MAVSANRLELLQIADAVAREKVIDREIVLAAMADAIQKAARSRYGSETNIRADINSKTGE
IRLQRLLEVVDVAEDYGTQIPLTLALDRNVDAKIGDFIADPLPPMDFGRIAAQSAKQVIV
QKVREAERDRQFDEFKDRVGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDEMIPRENMRYG
DRVRAYVYDVRREQRGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIQIKSVARDPGSRAKI
AVVSNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSQDPASFIVNALQPAEVSKV
VLDEDSERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDIDIMTEAEESERRQKEFNERT
NLFMDALDVDEMVGQVLASEGFAAVEELAYVELDEISSIDGFDEDTATEIQTRAREYLER
IESENDAKRVALGVADELKQIDGLTGQMLVALGEDGIKTIEDFAGCAADDLVGWSERKDG
ETKKFEGLFSKFEVSRTEAENMVVQARLLAGWITDADLATEEAPEAEDAEEAPAAERE
Download sequence
Identical sequences A0A0Q5DFY5
WP_062454202.1.10298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]