SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q5QFP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q5QFP2
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily MbtH-like 5.23e-32
Family MbtH-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q5QFP2
Sequence length 73
Comment (tr|A0A0Q5QFP2|A0A0Q5QFP2_9ACTN) Antibiotic synthesis protein MbtH {ECO:0000313|EMBL:KQR96087.1} KW=Complete proteome; Reference proteome OX=1736349 OS=Williamsia sp. Leaf354. GN=ASG12_17835 OC=Williamsia.
Sequence
MSNPFDDENGRFFVLVNAENQHSLWPTFVDIPAGWDKVFGEASRAECLDYVNEHWTDLRP
KSLIEAMEADSAR
Download sequence
Identical sequences A0A0Q5QFP2
WP_055792581.1.47852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]