SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q5UCI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q5UCI6
Domain Number 1 Region: 113-233
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.89e-33
Family cAMP-binding domain 0.00000176
Further Details:      
 
Domain Number 2 Region: 243-365
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.94e-30
Family cAMP-binding domain 0.00000237
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.44e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q5UCI6
Sequence length 376
Comment (tr|A0A0Q5UCI6|A0A0Q5UCI6_DROER) Uncharacterized protein, isoform C {ECO:0000313|EMBL:KQS44333.1} KW=Complete proteome OX=7220 OS=Drosophila erecta (Fruit fly). GN=Dere_GG16143 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSYMMAKTLEEQSLRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQ
VKLDASRQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTM
NALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVF
VNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKM
YEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQ
RSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADI
LKRNITQYNSFVSLSV
Download sequence
Identical sequences A0A0J9RYY1 A0A0Q5UCI6 A0A0R1E0E6 P16905
NP_001014593.1.81976 NP_001014594.1.81976 NP_001014595.1.81976 NP_001014596.1.81976 NP_730573.2.81976 NP_730574.2.81976 XP_015014124.1.56816 XP_015050799.1.41174 XP_016032741.1.80810 FBpp0289169 FBpp0289170 FBpp0289755 FBpp0289757 FBpp0289761 FBpp0289762 FBpp0289169 FBpp0289170 FBpp0289755 FBpp0289757 FBpp0289761 FBpp0289762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]