SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q5VBT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q5VBT7
Domain Number 1 Region: 24-155
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 9.42e-23
Family Peptidyl-tRNA hydrolase II 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q5VBT7
Sequence length 164
Comment (tr|A0A0Q5VBT7|A0A0Q5VBT7_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KQS58388.1} KW=Complete proteome; Reference proteome OX=1736354 OS=Geodermatophilus sp. Leaf369. GN=ASG36_09900 OC=Geodermatophilus.
Sequence
MTANEIGFLPDEVVTAEPTRNARLKWVVVVDAAVPAGEAVNAVACVAAATGAAVDNLLAH
GGPDADGVHHPGLPWAGCSVLTATAEELAAVRAKAVDSAGVLVVDMPRAAQTHRVYDGYL
AELVTTPGAELACRALSLVGPRNRVSAITKWLGLLTGGAASPPA
Download sequence
Identical sequences A0A0Q5VBT7
WP_055763344.1.20524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]