SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q6D2N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q6D2N1
Domain Number 1 Region: 113-169
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.0000000000915
Family PsbU-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q6D2N1
Sequence length 170
Comment (tr|A0A0Q6D2N1|A0A0Q6D2N1_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:KQT60062.1} KW=Complete proteome; Reference proteome OX=1736382 OS=Methylobacterium sp. Leaf456. GN=ASG52_18215 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MLSGSAILRVLLVLVAAAGIAGIVQFVWMRGTPTNTEPSAATRSEPSRPAPPPEPVPPEP
APPPAAEAPPSAPLSLPRREPTPPPAPAPAPPSAAPDPTEAAAENAPPAAVALVDLNTAT
LAELNGLKGGGAIGRTIIGHRPYTSVDQLLSKRVLNRATYQRIKDQVTVR
Download sequence
Identical sequences A0A0Q6D2N1
WP_056239607.1.47787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]