SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q6DQX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q6DQX1
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.000000000000602
Family PG0164-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q6DQX1
Sequence length 142
Comment (tr|A0A0Q6DQX1|A0A0Q6DQX1_9MICO) Uncharacterized protein {ECO:0000313|EMBL:KQT72200.1} KW=Complete proteome OX=1736377 OS=Microbacterium sp. Leaf436. GN=ASG45_14740 OC=Microbacterium.
Sequence
MRFETTLSQMGNNTGIEVPAEVVEALGGGRRAAVVVDVNGYVYPSTLAVMGGRQLIPFSA
DKRAATGLSGGDPIVVELRLDTAPRTVEVPDDLAAALDAAGARAAFDALAPSARKAHVAN
VEGAKTADTRARRITSLATKLG
Download sequence
Identical sequences A0A0Q6DQX1
WP_055839238.1.68246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]