SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q6ILB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q6ILB6
Domain Number 1 Region: 23-210
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 2.09e-44
Family MW0975(SA0943)-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q6ILB6
Sequence length 221
Comment (tr|A0A0Q6ILB6|A0A0Q6ILB6_9BACI) Chromosome partitioning protein {ECO:0000313|EMBL:KQU26647.1} KW=Complete proteome OX=1736235 OS=Bacillus sp. Leaf75. GN=ASG61_01480 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKCVGRYIIIGIAAMSLAGCAEGSSPELEVYNGLEKVVAQEKQFADQQKPLADLEQQENA
IYDQIIELGIKDKKKIKNKAQKAQQLLDERESKLQKEEKSISASQKQFEATEPKIQKLED
GKAKEEALELSSLMKKRYNAYQSLHDAYLHSIELDRQLYTLFEKDNVKLENLETQIASIN
ATYKEVEKKKETFNTLTADYNKAKEDFYNKTKLKVKNSEDK
Download sequence
Identical sequences A0A0M0WI94 A0A0Q6ILB6 A0A0Q9UN12 A0A2B2B3X1 D5E0B5
gi|294498112|ref|YP_003561812.1| WP_013056053.1.100032 WP_013056053.1.12495 WP_013056053.1.17588 WP_013056053.1.53165 WP_013056053.1.64554 WP_013056053.1.77219 WP_013056053.1.82953 WP_013056053.1.9085 WP_013056053.1.9244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]