SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q6MMD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q6MMD8
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 1.43e-17
Family NIPSNAP 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q6MMD8
Sequence length 230
Comment (tr|A0A0Q6MMD8|A0A0Q6MMD8_9BURK) Uncharacterized protein {ECO:0000313|EMBL:KQU81257.1} KW=Complete proteome; Reference proteome OX=1736511 OS=Rhizobacter sp. Root29. GN=ASC88_12985 OC=Rhizobacter.
Sequence
MPSPCAIVELRRYALHPGRRETLIELFDREFVHTQEDCGMRVLGQFRDLDAPDDFVWLRG
FSNMAERREALAAFYGGPVWRRHRDAANATMQDSSNVLLLRNVQTTATHAARPGMLLAVV
CQLDAPATPLLVHRFEHEVRPCLQAAGMEVQAVLMTEHAPNDFPALPVRTDTEALVWICR
FDSAAHQLDCADRLFASAIWRDAVWPRWLSQLSAAPQMFRLQPTAGSAWR
Download sequence
Identical sequences A0A0Q6MMD8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]