SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q7AJS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q7AJS9
Domain Number 1 Region: 117-239
Classification Level Classification E-value
Superfamily OmpA-like 5.49e-38
Family OmpA-like 0.00019
Further Details:      
 
Domain Number 2 Region: 77-111
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000889
Family TSP type-3 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q7AJS9
Sequence length 241
Comment (tr|A0A0Q7AJS9|A0A0Q7AJS9_9PSED) Uncharacterized protein {ECO:0000313|EMBL:KQW35786.1} KW=Complete proteome OX=1736526 OS=Pseudomonas sp. Root401. GN=ASC85_19760 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNVLIRAALPVLLASSLLSGCATHSDGSAPLNQRTWPICSLIGGLVGGGLGAIESSGWAA
GGAALGLLGGGLICYAQDGDEDDDGVFDRRDRCPDTPANTPVEHHGCPVPQYPASAPPVA
PEAPASEVITLNDAGKVLFDFDKSDLTAEARSQLDGLMSKLSHANVASIRVVGHTDSVGS
DAYNQGLSERRASSVVEYLLSQGLAPDKLTSEGKGESEPVADNETDEGRAQNRRVELHIQ
R
Download sequence
Identical sequences A0A0Q7AJS9
WP_057448879.1.100503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]