SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q7CHY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q7CHY8
Domain Number 1 Region: 7-115
Classification Level Classification E-value
Superfamily YdhG-like 8.37e-29
Family YdhG-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q7CHY8
Sequence length 124
Comment (tr|A0A0Q7CHY8|A0A0Q7CHY8_9BURK) Uncharacterized protein {ECO:0000313|EMBL:KQW64739.1} KW=Complete proteome OX=1736530 OS=Variovorax sp. Root411. GN=ASC92_04705 OC=Comamonadaceae; Variovorax.
Sequence
MASNPPTTIAEYIQAAPAEGQPHLRRVHAILKSVAPQAQEAIKWGTPFFVEPRFLFAFSA
HKAHLSFVPIEGAFEPFRKELEKHKTTKGTLRIPYDDPMPEELICKIAEHCLRTVSARKS
DAFW
Download sequence
Identical sequences A0A0Q7CHY8
WP_056510894.1.16572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]