SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q7EPK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q7EPK5
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 1.67e-45
Family Peptidyl-tRNA hydrolase II 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q7EPK5
Sequence length 135
Comment (tr|A0A0Q7EPK5|A0A0Q7EPK5_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:KQW85847.1} KW=Complete proteome; Reference proteome OX=1736531 OS=Devosia sp. Root413D1. GN=ASC89_01890 OC=Hyphomicrobiaceae; Devosia.
Sequence
MFDTKIAIVLREDLAPWQALNVTAFLAAGITAQHPEIIGEPYIDGAGNRFSSLSVQPVIV
LAADAEAMRSIHRRALERGIVTSAYIEEMFSTGHDAANREVFARFAPEDARVVGIGLRAE
RKIVDKVAKGARMHP
Download sequence
Identical sequences A0A0Q7EPK5
WP_055994140.1.67020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]