SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q7HJL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q7HJL3
Domain Number 1 Region: 7-60
Classification Level Classification E-value
Superfamily MbtH-like 1.44e-18
Family MbtH-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q7HJL3
Sequence length 67
Comment (tr|A0A0Q7HJL3|A0A0Q7HJL3_9ACTN) Antibiotic synthesis protein MbtH {ECO:0000313|EMBL:KQX27319.1} KW=Complete proteome OX=1736448 OS=Streptomyces sp. Root1295. GN=ASD29_28895 OC=Streptomyces.
Sequence
MSDASANPFDTDGEFLVLTNAEGQHSLWPLFAAVPEGWSTAHGPCARQDALDWIAAHWDG
PVAAAAR
Download sequence
Identical sequences A0A0Q7HJL3 A0A0Q8DPK3 A0A1Q5BW08
WP_050361544.1.23577 WP_050361544.1.298 WP_050361544.1.34395 WP_050361544.1.85828 WP_050361544.1.92720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]