SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q7KCD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q7KCD3
Domain Number 1 Region: 13-216
Classification Level Classification E-value
Superfamily Prim-pol domain 8.5e-30
Family Bifunctional DNA primase/polymerase N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q7KCD3
Sequence length 291
Comment (tr|A0A0Q7KCD3|A0A0Q7KCD3_9ACTN) DNA primase {ECO:0000313|EMBL:KQX77924.1} KW=Complete proteome; Reference proteome OX=1736454 OS=Streptomyces sp. Root1319. GN=ASD26_17165 OC=Streptomyces.
Sequence
MAIIDRQTATLALAHALSAAERGLPVFPLSANKLPALRSPHHDETPPTRCRGACGLPGHG
VHDATTHPAAVRALFAAAPRATGYGIACGRPPHRLIGIDLDIDPTHGNDSVAALQQLALQ
HLFTIPATVTVITPSGGRHLWLTGPSGVAVPNSASRLAPGIDVRGAGGYLVGPGSVTTHG
SYRLAPGTAHLPPAACPRTLLRLLTPPKRSHHATDSHSRTGQGRGLVQFVLAAHEGQRNT
RLFWAACRAYEHGFGDALADALTDAAVRTGLSEQEARAAIASAARLTTERP
Download sequence
Identical sequences A0A0Q7KCD3 A0A0Q7UBJ9
WP_056793093.1.45578 WP_056793093.1.63207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]