SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q7RUW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q7RUW4
Domain Number 1 Region: 126-256
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.39e-48
Family PH0987 C-terminal domain-like 0.0000078
Further Details:      
 
Domain Number 2 Region: 10-76,122-131
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.000000000000876
Family PH0987 N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q7RUW4
Sequence length 264
Comment (tr|A0A0Q7RUW4|A0A0Q7RUW4_9BACL) Kinase inhibitor {ECO:0000313|EMBL:KQY79682.1} KW=Complete proteome; Reference proteome OX=1736552 OS=Paenibacillus sp. Root52. GN=ASD24_19780 OC=Paenibacillus.
Sequence
MYLWTEEMLSPISESAIVIRCGDMISDEVHQRVMSVCSMLDHMHIPGLIEAVPSFASVTL
FYDPYLLMEYVSSNLDSTSTTIEIGGSYPRSRADSSATSPYIYLRDLLLPSLQGLQSVAP
KQTRTVTIPVCYGGEFGPDLEYVASVHALTPDEVIAIHTAGEYLVHMLGFAPGFPYLGGL
SARIATPRRATPRLRVEAGTVGIGGEQTGIYPLATPGGWQCIGRTPIALFRPDDNPPSLL
TAGDRVRFTPISIQEYFEHQGAKS
Download sequence
Identical sequences A0A0Q7RUW4
WP_056704173.1.68418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]