SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q7WCD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q7WCD4
Domain Number 1 Region: 27-129
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.00000301
Family Chemotaxis phosphatase CheZ 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q7WCD4
Sequence length 183
Comment (tr|A0A0Q7WCD4|A0A0Q7WCD4_9BURK) Chemotaxis protein {ECO:0000313|EMBL:KQZ34864.1} KW=Complete proteome OX=1736472 OS=Massilia sp. Root1485. GN=ASD92_07065 OC=Oxalobacteraceae; Massilia.
Sequence
MTTRKKILGSHVKRLLSGVSDHGRRHLSEVETDLVQTTLLLEEAVEKLTSSFMAIHHVVD
SRQEAINRLLAGQAPTAEESACLTGMSGEIAGHVNAAVTSMQFQDMTSQLLDRTLRRVTG
LREFLTTLSEHGDEILPESDGDEIVERLGKVSMALAIQSLELRSMLRKSVEQRHLESGDV
ELF
Download sequence
Identical sequences A0A0Q7WCD4
WP_056137231.1.72005 WP_056137231.1.92231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]