SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q7YZL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q7YZL7
Domain Number 1 Region: 12-105
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.00000000000000654
Family PG0164-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q7YZL7
Sequence length 107
Comment (tr|A0A0Q7YZL7|A0A0Q7YZL7_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:KQZ61832.1} KW=Complete proteome; Reference proteome OX=1736474 OS=Sphingopyxis sp. Root1497. GN=ASD67_21960 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MAGVESFTTTTPLWRWQSATAPAAWFFLTIDGEVADGIRVAAMSGQWLDKRGGFGSARVA
VTIGDTSWNTSVFPHKESGGWILPVKAAVRKAEGIAEGDDVTVTVSL
Download sequence
Identical sequences A0A0Q7YZL7
WP_056351667.1.50499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]