SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q8ELN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q8ELN9
Domain Number 1 Region: 85-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000719
Family NfeD domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q8ELN9
Sequence length 143
Comment (tr|A0A0Q8ELN9|A0A0Q8ELN9_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KRA46729.1} KW=Complete proteome; Reference proteome OX=1736574 OS=Pseudoxanthomonas sp. Root630. GN=ASD72_05990 OC=Xanthomonadaceae; Pseudoxanthomonas.
Sequence
MSFKFAFWAIGALVLFAAEAMAPGAFMLWFGFAAVAMAVVVLAVPGLGWLAQAVLFSVLA
LISVAVYRKWFRGKGRQSDKPLLNRRAEQLVGTVAVLDQAIAGGRGRVKIDDAFWTVEGP
DLPVGTRVRVVAVDGMTLKVQEA
Download sequence
Identical sequences A0A0Q8ELN9
WP_056879608.1.8670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]