SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q8GFV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q8GFV7
Domain Number 1 Region: 17-183
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 8.76e-34
Family Chemotaxis phosphatase CheZ 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q8GFV7
Sequence length 184
Comment (tr|A0A0Q8GFV7|A0A0Q8GFV7_9BURK) Chemotaxis protein CheZ {ECO:0000256|PIRNR:PIRNR002884} KW=Complete proteome OX=1736580 OS=Pelomonas sp. Root662. GN=ASD88_20240 OC=Comamonadaceae; Pelomonas.
Sequence
MSDASIHAVIQADAVQVLHDVVEELPDARERLAYVRSMTEQAATKVLNLVEAAQGDAEAV
RKKGRELSDALNRLALSSNISPDRARALMKLCAAYASDAASFAAREKSLHSEIMMSQDFQ
DLSGQVINKVSKMLERAEPPLRELVQSLPASVASAKPEVLGGVQTPDKAFKQDDVDDLLA
SLGF
Download sequence
Identical sequences A0A0Q7AXI7 A0A0Q8GFV7
WP_082536729.1.38204 WP_082536729.1.51473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]