SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q9A2T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9A2T2
Domain Number 1 Region: 58-127
Classification Level Classification E-value
Superfamily YdhG-like 0.000000000209
Family YdhG-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9A2T2
Sequence length 157
Comment (tr|A0A0Q9A2T2|A0A0Q9A2T2_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KRD11908.1} KW=Complete proteome; Reference proteome OX=1736503 OS=Streptomyces sp. Root264. GN=ASE41_29245 OC=Streptomyces.
Sequence
MTNTQQPAAGSTAPEKFDGFTAEERAAMKEHARDLKTTARRSPRTAKADGEKDVLAKIAD
MADADRVLAEALHRIVTAAAPDLAPKLWYGMPAYARNGKVVCFFQSAQKFKTRYATLGFS
DQAYLDDDAMWPTTYALTKLDAATESRITELVARAAG
Download sequence
Identical sequences A0A0Q9A2T2
WP_057581114.1.28160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]