SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q9FVL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9FVL0
Domain Number 1 Region: 12-56
Classification Level Classification E-value
Superfamily BAS1536-like 0.0000000129
Family BAS1536-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9FVL0
Sequence length 60
Comment (tr|A0A0Q9FVL0|A0A0Q9FVL0_9BACI) Sporulation protein {ECO:0000313|EMBL:KRD82538.1} KW=Complete proteome OX=1736468 OS=Bacillus sp. Root147. GN=ASE51_23420 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MQTNRYSNTLRKALLVDIEAGRELMIQIGLEEGLASKNTIVISQFIDQLLNRLEKVTETN
Download sequence
Identical sequences A0A0Q9FVL0
WP_057240521.1.15866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]