SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q9HZK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9HZK9
Domain Number 1 Region: 99-229
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.55e-49
Family PH0987 C-terminal domain-like 0.00000558
Further Details:      
 
Domain Number 2 Region: 6-104
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 1.7e-17
Family PH0987 N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9HZK9
Sequence length 240
Comment (tr|A0A0Q9HZK9|A0A0Q9HZK9_9BACI) Kinase inhibitor {ECO:0000313|EMBL:KRE10321.1} KW=Complete proteome OX=1736499 OS=Bacillus sp. Root239. GN=ASE46_01785 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSHDYRLYPLGDSGIVVSFGDEINLGIHKRIQQFTEVLEQSLCKGMIEYVPAFTTVTIYY
DPWIMSEKGRRNPYTAISTYIEELLFRQEEKSEAIARQIEIPVCYGGKYGPDLERIAAFH
SLTPDEVISIHTNGEYLVYMIGFAPGFPYLGGMSKEIATPRKESPRNSIPKGSVGIAGMQ
TGVYPIETPGGWQLIGRTPLTLFNPKKDSPSLLQAGDRIRFVSISETEYEAQKEVDEDEY
Download sequence
Identical sequences A0A0Q9HZK9
WP_057241516.1.12923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]