SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q9S4R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9S4R9
Domain Number 1 Region: 31-136
Classification Level Classification E-value
Superfamily TIMP-like 0.000000000000131
Family Tissue inhibitor of metalloproteinases, TIMP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9S4R9
Sequence length 205
Comment (tr|A0A0Q9S4R9|A0A0Q9S4R9_9MICO) Uncharacterized protein {ECO:0000313|EMBL:KRF22865.1} KW=Complete proteome; Reference proteome OX=1736414 OS=Phycicoccus sp. Soil802. GN=ASG91_15900 OC=Phycicoccus.
Sequence
MRPTVMKRALLVVPLVFAALLVLPTAPAWACSCAAATPAQLVDRSDVVLRGTLGDVAEPA
GLAEPSSGAPARSYRFTVAEVYRGTVAPTTWVGSAADGASCGLEGLEPGREYVVFAQERG
EELWANLCGGTAPADTRLVGEVEAVAGPGQAPAQALPESPSGQPPGAVAPGSERAWLVPL
LGGLALALGLGVALVVVVQRGHRRE
Download sequence
Identical sequences A0A0Q9S4R9
WP_056923602.1.28312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]