SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q9X0Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9X0Z5
Domain Number 1 Region: 32-57,175-352
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.66e-61
Family G proteins 0.000000144
Further Details:      
 
Domain Number 2 Region: 61-182
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.8e-43
Family Transducin (alpha subunit), insertion domain 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9X0Z5
Sequence length 354
Comment (tr|A0A0Q9X0Z5|A0A0Q9X0Z5_DROWI) Uncharacterized protein, isoform B {ECO:0000313|EMBL:KRF99171.1} KW=Complete proteome; Reference proteome OX=7260 OS=Drosophila willistoni (Fruit fly). GN=Dwil_GK17798 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESG
FTAEDFKQYRPVVYSNTIQSLVAILRAMPNLSIQYSNNERESDAKMVFDVCQRMHDTEPF
SEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRV
KTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDET
TNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEA
AAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Download sequence
Identical sequences A0A0P8XRN2 A0A0Q9X0Z5 A0A1W4VQ13
XP_014763885.1.52611 XP_014763886.1.52611 XP_015033117.1.14588 XP_016929986.1.48971 XP_016967935.1.21709 XP_016967937.1.21709 XP_016987222.1.97277 XP_017006057.1.47939 XP_017006058.1.47939 XP_017006059.1.47939 XP_017022016.1.37106 XP_017022017.1.37106 XP_017022018.1.37106 XP_017053937.1.74164 XP_017077796.1.81094 XP_017106785.1.53830 XP_017133023.1.32376 XP_020815662.1.32911 XP_020815663.1.32911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]